PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 805aa    MW: 91142.7 Da    PI: 7.9451
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054830.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.92.1e-1414921196
                    HHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 11 lksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                    + ++ l++p  f+ ++ +g +e++kt  l++  s  +W+vk+  ++++    l++GWkeF  a++L+ gD++vFk +++++f  +v++
  Csa07g054830.1 14 FHRH-LTIPVAFFLKNvQGRNEQKKTTELRSdASKITWKVKV--EGQR----LANGWKEFTLAHDLRIGDILVFKQERDMSF--HVTM 92
                    4555.9******999997777888899999868889******..8877....***********************8777888..7765 PP

2B378.38.1e-25133217490
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     + +++ +l+ + l lp +f++++g++++++ +++l +e+grsW+v l+ +k+ g++++++GW++F++angL++gDf++Fkl++r ++
  Csa07g054830.1 133 ANVTAPNLRYDSLNLPMSFVRANGLNTRCG-EMILINEKGRSWTVSLKRKKSCGTTYIRGGWRNFCQANGLRAGDFLTFKLIQR-GG 217
                     5678899999****************9987.****************98999999**************************996.33 PP

3B364.41.8e-20257352198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++v++++++ +++ l+lp +f++ +g++k++  ++++ d++g +W+ k++++  ++r+ l++GWkeF++ang+k g++++++l++  +++  +k
  Csa07g054830.1 257 FVTVTLTPYNIRESKLTLPIPFTKVYGLQKAK--KMSFLDTHGVKWSTKMCFEVERNRMRLEGGWKEFCNANGVKIGESIILELVWGADRSSGLK 349
                     789999***********************765..8*************************************************98766666666 PP

                     EE- CS
              B3  96 vfr 98 
                     +++
  Csa07g054830.1 350 FCS 352
                     665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.646396IPR003340B3 DNA binding domain
SuperFamilySSF1019366.67E-163102IPR015300DNA-binding pseudobarrel domain
CDDcd100174.11E-11593No hitNo description
SMARTSM010191.4E-18696IPR003340B3 DNA binding domain
PfamPF023621.5E-91590IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.3E-2016109IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-23123216IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-21129220IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086316.482130227IPR003340B3 DNA binding domain
CDDcd100171.07E-24130223No hitNo description
SMARTSM010197.0E-31131227IPR003340B3 DNA binding domain
PfamPF023621.1E-22132218IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-21249342IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-20253341IPR015300DNA-binding pseudobarrel domain
CDDcd100177.28E-17256341No hitNo description
PROSITE profilePS5086313.803257354IPR003340B3 DNA binding domain
PfamPF023621.1E-19257353IPR003340B3 DNA binding domain
SMARTSM010197.8E-21257354IPR003340B3 DNA binding domain
Gene3DG3DSA:1.20.1280.504.4E-5429465No hitNo description
SuperFamilySSF813834.71E-6430467IPR001810F-box domain
PfamPF006461.0E-4432467IPR001810F-box domain
PfamPF034781.2E-7669707IPR005174Domain unknown function DUF295
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 805 aa     Download sequence    Send to blast
MANQHFFKPL LLAFHRHLTI PVAFFLKNVQ GRNEQKKTTE LRSDASKITW KVKVEGQRLA  60
NGWKEFTLAH DLRIGDILVF KQERDMSFHV TMLGPSCCQI QYVSSLDNQN NLGKIQRKKQ  120
KAESSLDQSC FVANVTAPNL RYDSLNLPMS FVRANGLNTR CGEMILINEK GRSWTVSLKR  180
KKSCGTTYIR GGWRNFCQAN GLRAGDFLTF KLIQRGGTLG LRISPGEIEK EDCLLEGNVV  240
KSRSIWKASS SESQNRFVTV TLTPYNIRES KLTLPIPFTK VYGLQKAKKM SFLDTHGVKW  300
STKMCFEVER NRMRLEGGWK EFCNANGVKI GESIILELVW GADRSSGLKF CSKTFWWLLV  360
TFWMHTPLSK ISLLHADGHQ VLGTYSSPPS VLKLDLTETS SCIDCSLLLD CVSKLQLSPA  420
SKSAQPGTKE QWSLLPGELL QLILTYLDNC FEVVHVRSVC TSWRSSIPFP SSLLRPSYSL  480
PTFADFPYDS LDLCILEKIP LFFFRVRDTS PCEYFLGDIG LDESEHNHME PLQCTVKVKT  540
TLMNMLDCQI ISLGHQYRMI GWDPEAWTSE LTEAWLCFHA SCWDLFTFRG RFYAVFLSGE  600
IFVIDPCSLE ATPFKPSKPL NSSNYLVPSG DDELFLVEKI VPRYGELNYF RFVCRVSRLD  660
EEAGEWVVVS DLGDRVLFIG ELGNFSCSAK ELPRGCGVSG NSVLFTNGPG NVTYAYKYGV  720
ETGNAGENLC FWRFLRENRV MILNRSPPVV ALQDSGSTLF SKDQKEAYEV ECDEESSQDE  780
SISQECSGRK EKKYLPLPFT KVNT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGscaffold_400948.11e-168(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-109B3 family protein